Lineage for d2v47c1 (2v47 C:18-224)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249705Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 2249706Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 2249707Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 2249708Protein Ribosomal protein L1 [56810] (4 species)
  7. 2249719Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 2249728Domain d2v47c1: 2v47 C:18-224 [152509]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1

Details for d2v47c1

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOPe Domain Sequences for d2v47c1:

Sequence, based on SEQRES records: (download)

>d2v47c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaarlvkelatakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlai
akgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgsklgrilgprgll
pnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppekladnirafirale
ahkpegakgtflrsvyvtttmgpsvri

Sequence, based on observed residues (ATOM records): (download)

>d2v47c1 e.24.1.1 (C:18-224) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri

SCOPe Domain Coordinates for d2v47c1:

Click to download the PDB-style file with coordinates for d2v47c1.
(The format of our PDB-style files is described here.)

Timeline for d2v47c1: