![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
![]() | Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
![]() | Protein Ribosomal protein L34p [144323] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries) Uniprot P80340 1-49 |
![]() | Domain d2v4771: 2v47 7:1-49 [152508] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 7:1-49 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v4771:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4771 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr
Timeline for d2v4771: