SCOPe 2.06: Domain d2v4761: 2v47 6:9-53

Lineage for d2v4761 (2v47 6:9-53)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
   Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members

6. Protein Ribosomal protein L33p [144204] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries)
   Uniprot P35871 8-52

8. Domain d2v4761: 2v47 6:9-53 [152507]
   Other proteins in same PDB: d2v4741, d2v4751, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1

Details for d2v4761

PDB Entry: 2v47, 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.

PDB Compounds: (6:) 50S ribosomal protein L33

SCOPe Domain Sequences for d2v4761:

Sequence; same for both SEQRES and ATOM records:

>d2v4761 g.41.8.6 (6:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]}
lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk

Timeline for d2v4761:

• d2v4761 first appeared in SCOP 1.75
  
• d2v4761 appears in SCOPe 2.05
  
• d2v4761 appears in SCOPe 2.07
  
• d2v4761 appears in the current release, SCOPe 2.08