| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() automatically mapped to Pfam PF01649 |
| Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
| Protein Ribosomal protein S20 [46994] (2 species) |
| Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
| Domain d2v46t1: 2v46 T:8-106 [152502] Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46u1, d2v46y1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v46 (more details), 3.8 Å
SCOPe Domain Sequences for d2v46t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v46t1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d2v46t1: