Lineage for d2v46t1 (2v46 T:8-106)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908369Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 908370Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 908371Protein Ribosomal protein S20 [46994] (2 species)
  7. 908399Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 908430Domain d2v46t1: 2v46 T:8-106 [152502]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46u1, d2v46y1
    automatically matched to d1i94t_
    complexed with mg, zn

Details for d2v46t1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2v46t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46t1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2v46t1:

Click to download the PDB-style file with coordinates for d2v46t1.
(The format of our PDB-style files is described here.)

Timeline for d2v46t1: