Lineage for d2v46r1 (2v46 R:19-88)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907572Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 907573Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 907574Protein Ribosomal protein S18 [46913] (2 species)
  7. 907600Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 907631Domain d2v46r1: 2v46 R:19-88 [152500]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
    automatically matched to d2j00r1
    complexed with mg, zn

Details for d2v46r1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2v46r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46r1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2v46r1:

Click to download the PDB-style file with coordinates for d2v46r1.
(The format of our PDB-style files is described here.)

Timeline for d2v46r1: