Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
Domain d2v46p1: 2v46 P:1-83 [152498] Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46m1, d2v46n1, d2v46q1, d2v46r1, d2v46t1, d2v46u1, d2v46y1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v46 (more details), 3.8 Å
SCOPe Domain Sequences for d2v46p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v46p1 i.1.1.1 (P:1-83) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d2v46p1: