Lineage for d2v46n1 (2v46 N:2-61)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463710Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)
  6. 1463711Protein Ribosomal protein S14 [57753] (2 species)
  7. 1463737Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
    Uniprot P24320
  8. 1463769Domain d2v46n1: 2v46 N:2-61 [152496]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
    automatically matched to d1fjgn_
    complexed with mg, zn

Details for d2v46n1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2v46n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

SCOPe Domain Coordinates for d2v46n1:

Click to download the PDB-style file with coordinates for d2v46n1.
(The format of our PDB-style files is described here.)

Timeline for d2v46n1: