SCOP 1.75: Domain d2v46n1: 2v46 N:2-61

Lineage for d2v46n1 (2v46 N:2-61)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (45 PDB entries)
   Uniprot P24320

8. Domain d2v46n1: 2v46 N:2-61 [152496]
   Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
   automatically matched to d1fjgn_
   complexed with 5mu, mg, zn

Details for d2v46n1

PDB Entry: 2v46, 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOP Domain Sequences for d2v46n1:

Sequence; same for both SEQRES and ATOM records:

>d2v46n1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d2v46n1:

• d2v46n1 is new in SCOP 1.75
  
• d2v46n1 appears in SCOPe 2.01
  
• d2v46n1 appears in the current release, SCOPe 2.08