| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() automatically mapped to Pfam PF00338 |
| Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
| Protein Ribosomal protein S10 [55001] (2 species) |
| Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
| Domain d2v46j1: 2v46 J:3-100 [152492] Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46g1, d2v46h1, d2v46i1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v46 (more details), 3.8 Å
SCOPe Domain Sequences for d2v46j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v46j1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d2v46j1: