Lineage for d2v46g1 (2v46 G:2-156)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003977Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2003978Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2003979Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2003980Protein Ribosomal protein S7 [47975] (4 species)
  7. 2004010Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2004042Domain d2v46g1: 2v46 G:2-156 [152489]
    Other proteins in same PDB: d2v46b1, d2v46d1, d2v46e1, d2v46f1, d2v46h1, d2v46i1, d2v46j1, d2v46k1, d2v46l1, d2v46m1, d2v46n1, d2v46o1, d2v46p1, d2v46q1, d2v46r1, d2v46s1, d2v46t1, d2v46u1, d2v46y1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v46g1

PDB Entry: 2v46 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 1 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 1.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2v46g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v46g1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2v46g1:

Click to download the PDB-style file with coordinates for d2v46g1.
(The format of our PDB-style files is described here.)

Timeline for d2v46g1: