SCOPe 2.05: Domain d2v45a1: 2v45 A:601-723

Lineage for d2v45a1 (2v45 A:601-723)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Periplasmic nitrate reductase alpha chain, NapA [50706] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [50707] (5 PDB entries)
   dissimilatory nitrate reductase (NAP)

8. Domain d2v45a1: 2v45 A:601-723 [152483]
   Other proteins in same PDB: d2v45a2
   automated match to d2napa1
   complexed with lcp, mgd, mo, sf4, unx

Details for d2v45a1

PDB Entry: 2v45, 2.4 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand

PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2v45a1:

Sequence; same for both SEQRES and ATOM records:

>d2v45a1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

Timeline for d2v45a1:

• d2v45a1 first appeared in SCOP 1.75
  
• d2v45a1 appears in SCOPe 2.04
  
• d2v45a1 appears in SCOPe 2.06
  
• d2v45a1 appears in the current release, SCOPe 2.08