SCOPe 2.03: Domain d2v3za1: 2v3z A:1-176

Lineage for d2v3za1 (2v3z A:1-176)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (26 PDB entries)

8. Domain d2v3za1: 2v3z A:1-176 [152481]
   Other proteins in same PDB: d2v3za2
   automatically matched to d1a16a1
   complexed with cl, mn

Details for d2v3za1

PDB Entry: 2v3z, 1.56 Å

PDB Description: glu383ala escherichia coli aminopeptidase p in complex with substrate

PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2v3za1:

Sequence; same for both SEQRES and ATOM records:

>d2v3za1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d2v3za1:

• d2v3za1 first appeared in SCOP 1.75
  
• d2v3za1 appears in SCOPe 2.02
  
• d2v3za1 appears in SCOPe 2.04
  
• d2v3za1 appears in the current release, SCOPe 2.08