SCOPe 2.05: Domain d2v3ya2: 2v3y A:177-440

Lineage for d2v3ya2 (2v3y A:177-440)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (19 PDB entries)

8. Domain d2v3ya2: 2v3y A:177-440 [152480]
   Other proteins in same PDB: d2v3ya1
   automatically matched to d1a16a2
   complexed with cl, mn

Details for d2v3ya2

PDB Entry: 2v3y, 1.6 Å

PDB Description: his361ala escherichia coli aminopeptidase p in complex with product

PDB Compounds: (A:) xaa-pro aminopeptidase

SCOPe Domain Sequences for d2v3ya2:

Sequence; same for both SEQRES and ATOM records:

>d2v3ya2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvadvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d2v3ya2:

• d2v3ya2 first appeared in SCOP 1.75
  
• d2v3ya2 appears in SCOPe 2.04
  
• d2v3ya2 appears in SCOPe 2.06
  
• d2v3ya2 appears in the current release, SCOPe 2.08