| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (15 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [254984] (35 PDB entries) |
| Domain d2v3wd2: 2v3w D:2-181 [152475] Other proteins in same PDB: d2v3wa1, d2v3wb1, d2v3wc1, d2v3wd1 automated match to d2fwna2 complexed with mg, so4, tpp |
PDB Entry: 2v3w (more details), 2.2 Å
SCOPe Domain Sequences for d2v3wd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v3wd2 c.36.1.0 (D:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
Timeline for d2v3wd2: