Lineage for d2v3wd2 (2v3w D:2-181)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844736Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 1844737Protein automated matches [227126] (15 species)
    not a true protein
  7. 1844885Species Pseudomonas putida [TaxId:303] [254984] (35 PDB entries)
  8. 1844992Domain d2v3wd2: 2v3w D:2-181 [152475]
    Other proteins in same PDB: d2v3wa1, d2v3wb1, d2v3wc1, d2v3wd1
    automated match to d2fwna2
    complexed with mg, so4, tpp

Details for d2v3wd2

PDB Entry: 2v3w (more details), 2.2 Å

PDB Description: crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida
PDB Compounds: (D:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d2v3wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3wd2 c.36.1.0 (D:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d2v3wd2:

Click to download the PDB-style file with coordinates for d2v3wd2.
(The format of our PDB-style files is described here.)

Timeline for d2v3wd2: