Lineage for d2v3wc3 (2v3w C:342-525)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 829076Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 829100Protein Benzoylformate decarboxylase [88756] (1 species)
  7. 829101Species Pseudomonas putida [TaxId:303] [88757] (9 PDB entries)
    Uniprot P20906
  8. 829111Domain d2v3wc3: 2v3w C:342-525 [152473]
    Other proteins in same PDB: d2v3wa1, d2v3wa2, d2v3wb1, d2v3wb2, d2v3wc1, d2v3wc2, d2v3wd1, d2v3wd2
    automatically matched to d1mcza3
    complexed with mg, so4, tpp; mutant

Details for d2v3wc3

PDB Entry: 2v3w (more details), 2.2 Å

PDB Description: crystal structure of the benzoylformate decarboxylase variant l461a from pseudomonas putida
PDB Compounds: (C:) Benzoylformate decarboxylase

SCOP Domain Sequences for d2v3wc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3wc3 c.36.1.9 (C:342-525) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygaa
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs

SCOP Domain Coordinates for d2v3wc3:

Click to download the PDB-style file with coordinates for d2v3wc3.
(The format of our PDB-style files is described here.)

Timeline for d2v3wc3: