| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (11 species) not a true protein |
| Domain d2v3wc1: 2v3w C:182-341 [152471] Other proteins in same PDB: d2v3wa2, d2v3wa3, d2v3wb2, d2v3wb3, d2v3wc2, d2v3wc3, d2v3wd2, d2v3wd3 automated match to d1q6za1 complexed with mg, so4, tpp |
PDB Entry: 2v3w (more details), 2.2 Å
SCOPe Domain Sequences for d2v3wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v3wc1 c.31.1.0 (C:182-341) automated matches {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d2v3wc1: