Lineage for d2v3va1 (2v3v A:601-723)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798647Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1798648Protein automated matches [191195] (6 species)
    not a true protein
  7. 1798649Species Desulfovibrio desulfuricans [TaxId:876] [255266] (3 PDB entries)
  8. 1798650Domain d2v3va1: 2v3v A:601-723 [152463]
    Other proteins in same PDB: d2v3va2
    automated match to d2v3va1
    complexed with lcp, mgd, mo, sf4, unx

Details for d2v3va1

PDB Entry: 2v3v (more details), 1.99 Å

PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d2v3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3va1 b.52.2.0 (A:601-723) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka

SCOPe Domain Coordinates for d2v3va1:

Click to download the PDB-style file with coordinates for d2v3va1.
(The format of our PDB-style files is described here.)

Timeline for d2v3va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v3va2