Lineage for d2v3ia_ (2v3i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780027Species Hypocrea jecorina [TaxId:51453] [187227] (2 PDB entries)
  8. 2780028Domain d2v3ia_: 2v3i A: [152458]
    automated match to d1cela_
    complexed with co, gol, nag, xx6

Details for d2v3ia_

PDB Entry: 2v3i (more details), 1.05 Å

PDB Description: hypocrea jecorina cel7a in complex with (r)-dihydroxy-phenanthrenolol
PDB Compounds: (A:) exoglucanase 1

SCOPe Domain Sequences for d2v3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3ia_ b.29.1.10 (A:) automated matches {Hypocrea jecorina [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d2v3ia_:

Click to download the PDB-style file with coordinates for d2v3ia_.
(The format of our PDB-style files is described here.)

Timeline for d2v3ia_: