Lineage for d2v3ea2 (2v3e A:78-431)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 815744Family c.1.8.3: beta-glycanases [51487] (26 proteins)
    consist of a number of sequence families
  6. 816093Protein Glucosylceramidase, catalytic domain [89473] (1 species)
    acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases
  7. 816094Species Human (Homo sapiens) [TaxId:9606] [89474] (11 PDB entries)
  8. 816103Domain d2v3ea2: 2v3e A:78-431 [152450]
    Other proteins in same PDB: d2v3ea1, d2v3eb1
    automatically matched to d1ogsa2
    complexed with bma, fuc, nag, nnd, po4

Details for d2v3ea2

PDB Entry: 2v3e (more details), 2 Å

PDB Description: acid-beta-glucosidase with n-nonyl-deoxynojirimycin
PDB Compounds: (A:) glucosylceramidase

SCOP Domain Sequences for d2v3ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3ea2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad
tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl
kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr
dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl
apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg
wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs

SCOP Domain Coordinates for d2v3ea2:

Click to download the PDB-style file with coordinates for d2v3ea2.
(The format of our PDB-style files is described here.)

Timeline for d2v3ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v3ea1