SCOPe 2.07: Domain d2v3cb_: 2v3c B:

Lineage for d2v3cb_ (2v3c B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (2 families)
   automatically mapped to Pfam PF01922

5. Family d.201.1.1: SRP19 [69696] (1 protein)

6. Protein SRP19 [69697] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [75417] (4 PDB entries)

8. Domain d2v3cb_: 2v3c B: [152444]
   automated match to d1lnga_
   protein/RNA complex

Details for d2v3cb_

PDB Entry: 2v3c, 2.5 Å

PDB Description: crystal structure of the srp54-srp19-7s.s srp rna complex of m. jannaschii

PDB Compounds: (B:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d2v3cb_:

Sequence; same for both SEQRES and ATOM records:

>d2v3cb_ d.201.1.1 (B:) SRP19 {Methanococcus jannaschii [TaxId: 2190]}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn

Timeline for d2v3cb_:

• d2v3cb_ first appeared in SCOP 1.75, called d2v3cb1
  
• d2v3cb_ appears in SCOPe 2.06
  
• d2v3cb_ appears in the current release, SCOPe 2.08