SCOP 1.75: Domain d2v3cb1: 2v3c B:1-87

Lineage for d2v3cb1 (2v3c B:1-87)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.201: SRP19 [69694] (1 superfamily)
   beta-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.201.1: SRP19 [69695] (1 family)

5. Family d.201.1.1: SRP19 [69696] (1 protein)

6. Protein SRP19 [69697] (3 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [75417] (3 PDB entries)

8. Domain d2v3cb1: 2v3c B:1-87 [152444]
   automatically matched to d1lnga_

Details for d2v3cb1

PDB Entry: 2v3c, 2.5 Å

PDB Description: crystal structure of the srp54-srp19-7s.s srp rna complex of m. jannaschii

PDB Compounds: (B:) signal recognition particle 19 kda protein

SCOP Domain Sequences for d2v3cb1:

Sequence; same for both SEQRES and ATOM records:

>d2v3cb1 d.201.1.1 (B:1-87) SRP19 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn

Timeline for d2v3cb1:

• d2v3cb1 is new in SCOP 1.75
  
• d2v3cb1 is called d2v3cb_ in SCOPe 2.01
  
• d2v3cb1 appears in the current release, SCOPe 2.08, called d2v3cb_