Lineage for d2v3cb_ (2v3c B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006116Fold d.201: SRP19 [69694] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006117Superfamily d.201.1: SRP19 [69695] (2 families) (S)
    automatically mapped to Pfam PF01922
  5. 3006118Family d.201.1.1: SRP19 [69696] (1 protein)
  6. 3006119Protein SRP19 [69697] (3 species)
  7. 3006128Species Methanococcus jannaschii [TaxId:2190] [75417] (4 PDB entries)
  8. 3006131Domain d2v3cb_: 2v3c B: [152444]
    automated match to d1lnga_
    protein/RNA complex

Details for d2v3cb_

PDB Entry: 2v3c (more details), 2.5 Å

PDB Description: crystal structure of the srp54-srp19-7s.s srp rna complex of m. jannaschii
PDB Compounds: (B:) signal recognition particle 19 kda protein

SCOPe Domain Sequences for d2v3cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3cb_ d.201.1.1 (B:) SRP19 {Methanococcus jannaschii [TaxId: 2190]}
miiwpsyidkkksrregrkvpeelaiekpslkdiekalkklglepkiyrdkryprqhwei
cgcvevdykgnklqllkeickiikgkn

SCOPe Domain Coordinates for d2v3cb_:

Click to download the PDB-style file with coordinates for d2v3cb_.
(The format of our PDB-style files is described here.)

Timeline for d2v3cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2v3ca_