Lineage for d2v38a_ (2v38 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094328Species Bacillus agaradhaerens [TaxId:76935] [187246] (1 PDB entry)
  8. 2094329Domain d2v38a_: 2v38 A: [152442]
    automated match to d1e5ja_
    complexed with gol, idr, ifl, so4

Details for d2v38a_

PDB Entry: 2v38 (more details), 1.5 Å

PDB Description: family 5 endoglucanase cel5a from bacillus agaradhaerens in complex with cellobio-derived noeuromycin
PDB Compounds: (A:) endoglucanase 5a

SCOPe Domain Sequences for d2v38a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v38a_ c.1.8.3 (A:) automated matches {Bacillus agaradhaerens [TaxId: 76935]}
svveehgqlsisngelvnergeqvqlkgmsshglqwygqfvnyesmkwlrddwginvfra
amytssggyiddpsvkekvkeaveaaidldiyviidwhilsdndpniykeeakdffdems
elygdypnviyeianepngsdvtwgnqikpyaeevipiirnndpnniiivgtgtwsqdvh
haadnqladpnvmyafhfyagthgqnlrdqvdyaldqgaaifvsewgtsaatgdggvfld
eaqvwidfmdernlswanwslthkdessaalmpganptggwteaelspsgtfvrekires
a

SCOPe Domain Coordinates for d2v38a_:

Click to download the PDB-style file with coordinates for d2v38a_.
(The format of our PDB-style files is described here.)

Timeline for d2v38a_: