Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
Protein Fusion glycoprotein E1 [74840] (1 species) |
Species Semliki forest virus [TaxId:11033] [74841] (3 PDB entries) |
Domain d2v33a_: 2v33 A: [152439] automated match to d2v33a1 complexed with no3 |
PDB Entry: 2v33 (more details), 1.55 Å
SCOPe Domain Sequences for d2v33a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v33a_ b.1.18.4 (A:) Fusion glycoprotein E1 {Semliki forest virus [TaxId: 11033]} eaptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagk vtlhfstasaspsfvvslcsaratcsascep
Timeline for d2v33a_: