Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries) Uniprot P01892 25-298 |
Domain d2v2wa2: 2v2w A:1-181 [152428] Other proteins in same PDB: d2v2wa1, d2v2wb_, d2v2wd1, d2v2we_ automatically matched to d1akja2 |
PDB Entry: 2v2w (more details), 1.6 Å
SCOPe Domain Sequences for d2v2wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v2wa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2v2wa2:
View in 3D Domains from other chains: (mouse over for more information) d2v2wb_, d2v2wd1, d2v2wd2, d2v2we_ |