Lineage for d2v2tb2 (2v2t B:38-250)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378105Protein automated matches [254629] (2 species)
    not a true protein
  7. 2378108Species Mouse (Mus musculus) [TaxId:10090] [255600] (3 PDB entries)
  8. 2378111Domain d2v2tb2: 2v2t B:38-250 [152426]
    Other proteins in same PDB: d2v2ta1, d2v2ta2, d2v2tb1
    automated match to d1nfka2
    protein/DNA complex

Details for d2v2tb2

PDB Entry: 2v2t (more details), 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex
PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2v2tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2tb2 b.2.5.3 (B:38-250) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
lpdstgsftrrlepvvsdaiydskapnasnlki

SCOPe Domain Coordinates for d2v2tb2:

Click to download the PDB-style file with coordinates for d2v2tb2.
(The format of our PDB-style files is described here.)

Timeline for d2v2tb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v2tb1