SCOPe 2.06: Domain d2v2tb2: 2v2t B:38-250

Lineage for d2v2tb2 (2v2t B:38-250)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein automated matches [254629] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255600] (2 PDB entries)

8. Domain d2v2tb2: 2v2t B:38-250 [152426]
   Other proteins in same PDB: d2v2ta1, d2v2ta2, d2v2tb1
   automated match to d1nfka2
   protein/DNA complex

Details for d2v2tb2

PDB Entry: 2v2t, 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex

PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2v2tb2:

Sequence; same for both SEQRES and ATOM records:

>d2v2tb2 b.2.5.3 (B:38-250) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivql
vtngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmte
acirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftaf
lpdstgsftrrlepvvsdaiydskapnasnlki

Timeline for d2v2tb2:

• d2v2tb2 first appeared in SCOP 1.75
  
• d2v2tb2 appears in SCOPe 2.05
  
• d2v2tb2 appears in SCOPe 2.07
  
• d2v2tb2 appears in the current release, SCOPe 2.08