SCOP 1.75: Domain d2v2tb2: 2v2t B:39-247

Lineage for d2v2tb2 (2v2t B:39-247)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49425] (8 PDB entries)

8. Domain d2v2tb2: 2v2t B:39-247 [152426]
   Other proteins in same PDB: d2v2tb1
   automatically matched to d1le5b2

Details for d2v2tb2

PDB Entry: 2v2t, 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex

PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOP Domain Sequences for d2v2tb2:

Sequence; same for both SEQRES and ATOM records:

>d2v2tb2 b.2.5.3 (B:39-247) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
pdstgsftrrlepvvsdaiydskapnasn

Timeline for d2v2tb2:

• d2v2tb2 is new in SCOP 1.75
  
• d2v2tb2 appears in SCOPe 2.01
  
• d2v2tb2 appears in the current release, SCOPe 2.08