SCOPe 2.07: Domain d2v2tb1: 2v2t B:251-350

Lineage for d2v2tb1 (2v2t B:251-350)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)

8. Domain d2v2tb1: 2v2t B:251-350 [152425]
   Other proteins in same PDB: d2v2ta1, d2v2tb2
   automated match to d1ooaa1
   protein/DNA complex

Details for d2v2tb1

PDB Entry: 2v2t, 3.05 Å

PDB Description: x-ray structure of a nf-kb p50-relb-dna complex

PDB Compounds: (B:) Nuclear factor NF-kappa-B p105 subunit

SCOPe Domain Sequences for d2v2tb1:

Sequence; same for both SEQRES and ATOM records:

>d2v2tb1 b.1.18.0 (B:251-350) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d2v2tb1:

• d2v2tb1 first appeared in SCOP 1.75
  
• d2v2tb1 appears in SCOPe 2.06
  
• d2v2tb1 appears in the current release, SCOPe 2.08