Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d2v2ia_ (2v2i A:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein (Apo)ferritin [47246] (8 species)
  7. Species Horse (Equus caballus), L chain [TaxId:9796] [47248] (44 PDB entries)
  8. Domain d2v2ia_: 2v2i A: [152423]
    automated match to d1data_
    complexed with cd, gol, so4

Details for d2v2ia_

PDB Entry: 2v2i (more details)
PDB Description: wild type recombinant horse spleen apoferritin cocrystallized with haemin in acidic conditions
PDB Compounds: (A:) ferritin light chain

SCOP Domain Sequences for d2v2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2ia_ a.25.1.1 (A:) (Apo)ferritin {Horse (Equus caballus), L chain [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltl

SCOP Domain Coordinates for d2v2ia_:

Click to download the PDB-style file with coordinates for d2v2ia_.
(The format of our PDB-style files is described here.)

Timeline for d2v2ia_:

d2v2ia_ appears in SCOP 1.75A


d2v2ia_
(click for larger image)


d2v2ia_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu