SCOP 1.75: Domain d2v22d1: 2v22 D:181-308

Lineage for d2v22d1 (2v22 D:181-308)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
   Uniprot P20248 175-432

8. Domain d2v22d1: 2v22 D:181-308 [152421]
   automatically matched to d1vina1
   complexed with c35

Details for d2v22d1

PDB Entry: 2v22, 2.6 Å

PDB Description: replace: a strategy for iterative design of cyclin binding groove inhibitors

PDB Compounds: (D:) Cyclin-A2

SCOP Domain Sequences for d2v22d1:

Sequence; same for both SEQRES and ATOM records:

>d2v22d1 a.74.1.1 (D:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d2v22d1:

• d2v22d1 is new in SCOP 1.75
  
• d2v22d1 appears in SCOPe 2.01
  
• d2v22d1 appears in the current release, SCOPe 2.08