SCOPe 2.07: Domain d2v21c_: 2v21 C:

Lineage for d2v21c_ (2v21 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.2: Dodecin-like [89807] (2 families)

5. Family d.230.2.1: Dodecin-like [89808] (3 proteins)
   Subunit assembly and a probable biological unit is a dodecamer, hence the name
   automatically mapped to Pfam PF07311

6. Protein automated matches [190247] (4 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187586] (6 PDB entries)

8. Domain d2v21c_: 2v21 C: [152415]
   automated match to d2cz8a1
   complexed with fmn, na

Details for d2v21c_

PDB Entry: 2v21, 2.4 Å

PDB Description: crystal structure of the t. thermophilus dodecin in complex with prebound fmn

PDB Compounds: (C:) hypothetical protein ttha1431

SCOPe Domain Sequences for d2v21c_:

Sequence; same for both SEQRES and ATOM records:

>d2v21c_ d.230.2.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrleet

Timeline for d2v21c_:

• d2v21c_ first appeared in SCOP 1.75, called d2v21c1
  
• d2v21c_ appears in SCOPe 2.06
  
• d2v21c_ appears in the current release, SCOPe 2.08