Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (3 PDB entries) |
Domain d2v1rb_: 2v1r B: [152412] automated match to d1jqqb_ |
PDB Entry: 2v1r (more details), 2.1 Å
SCOPe Domain Sequences for d2v1rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v1rb_ b.34.2.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyip ynyieiik
Timeline for d2v1rb_: