SCOPe 2.08: Domain d2v1rb_: 2v1r B:

Lineage for d2v1rb_ (2v1r B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (4 PDB entries)

8. Domain d2v1rb_: 2v1r B: [152412]
   automated match to d1jqqb_

Details for d2v1rb_

PDB Entry: 2v1r, 2.1 Å

PDB Description: yeast pex13 sh3 domain complexed with a peptide from pex14 at 2.1 a resolution

PDB Compounds: (B:) peroxisomal membrane protein pas20

SCOPe Domain Sequences for d2v1rb_:

Sequence; same for both SEQRES and ATOM records:

>d2v1rb_ b.34.2.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyip
ynyieiik

Timeline for d2v1rb_:

• d2v1rb_ first appeared in SCOP 1.75, called d2v1rb1
  
• d2v1rb_ appears in SCOPe 2.07