SCOP 1.75: Domain d2v1ra1: 2v1r A:10-76

Lineage for d2v1ra1 (2v1r A:10-76)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (39 proteins)

6. Protein Peroxisomal membrane protein Pex13p [82055] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (4 PDB entries)

8. Domain d2v1ra1: 2v1r A:10-76 [152411]
   automatically matched to d1jqqb_
   complexed with ace

Details for d2v1ra1

PDB Entry: 2v1r, 2.1 Å

PDB Description: yeast pex13 sh3 domain complexed with a peptide from pex14 at 2.1 a resolution

PDB Compounds: (A:) peroxisomal membrane protein pas20

SCOP Domain Sequences for d2v1ra1:

Sequence; same for both SEQRES and ATOM records:

>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyip
ynyieii

Timeline for d2v1ra1:

• d2v1ra1 is new in SCOP 1.75
  
• d2v1ra1 is called d2v1ra_ in SCOPe 2.01
  
• d2v1ra1 appears in the current release, SCOPe 2.08, called d2v1ra_