Lineage for d2v1pa1 (2v1p A:5-471)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131390Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. 2131391Species Escherichia coli [TaxId:562] [159703] (7 PDB entries)
    Uniprot P0A853 5-471! Uniprot Q8XB34 5-471
  8. 2131392Domain d2v1pa1: 2v1p A:5-471 [152410]
    complexed with cl, mg; mutant

Details for d2v1pa1

PDB Entry: 2v1p (more details), 1.9 Å

PDB Description: crystal structure of the apo form of y74f mutant e. coli tryptophanase
PDB Compounds: (A:) trypthopanase

SCOPe Domain Sequences for d2v1pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]}
khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
aammrgdeafsgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
atytqthmdfiieafkhvkenaanikgltftyepkvlrhftaklkev

SCOPe Domain Coordinates for d2v1pa1:

Click to download the PDB-style file with coordinates for d2v1pa1.
(The format of our PDB-style files is described here.)

Timeline for d2v1pa1: