Lineage for d2v1cb1 (2v1c B:2-199)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057702Fold e.49: Recombination protein RecR [111303] (1 superfamily)
    consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)
  4. 1057703Superfamily e.49.1: Recombination protein RecR [111304] (1 family) (S)
  5. 1057704Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
    three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively
  6. 1057705Protein Recombination protein RecR [111306] (1 species)
  7. 1057706Species Deinococcus radiodurans [TaxId:1299] [111307] (2 PDB entries)
    Uniprot Q9ZNA2
  8. 1057712Domain d2v1cb1: 2v1c B:2-199 [152409]
    automatically matched to d1vdda_
    protein/DNA complex; complexed with zn; mutant

Details for d2v1cb1

PDB Entry: 2v1c (more details), 3.8 Å

PDB Description: crystal structure and mutational study of recor provide insight into its role in dna repair
PDB Compounds: (B:) recombination protein recr

SCOPe Domain Sequences for d2v1cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v1cb1 e.49.1.1 (B:2-199) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]}
kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
devtlgraltgrqtvskp

SCOPe Domain Coordinates for d2v1cb1:

Click to download the PDB-style file with coordinates for d2v1cb1.
(The format of our PDB-style files is described here.)

Timeline for d2v1cb1: