Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.49: Recombination protein RecR [111303] (1 superfamily) consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer) |
Superfamily e.49.1: Recombination protein RecR [111304] (1 family) |
Family e.49.1.1: Recombination protein RecR [111305] (1 protein) three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively |
Protein Recombination protein RecR [111306] (2 species) |
Species Deinococcus radiodurans [TaxId:1299] [111307] (2 PDB entries) Uniprot Q9ZNA2 |
Domain d2v1ca1: 2v1c A:2-199 [152408] automatically matched to d1vdda_ protein/DNA complex; complexed with zn; mutant |
PDB Entry: 2v1c (more details), 3.8 Å
SCOPe Domain Sequences for d2v1ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v1ca1 e.49.1.1 (A:2-199) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt devtlgraltgrqtvskp
Timeline for d2v1ca1: