SCOPe 2.08: Domain d2v1ca1: 2v1c A:2-199

Lineage for d2v1ca1 (2v1c A:2-199)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.49: Recombination protein RecR [111303] (1 superfamily)
   consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)

4. Superfamily e.49.1: Recombination protein RecR [111304] (2 families)

5. Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
   three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively

6. Protein Recombination protein RecR [111306] (2 species)

7. Species Deinococcus radiodurans [TaxId:1299] [111307] (2 PDB entries)
   Uniprot Q9ZNA2

8. Domain d2v1ca1: 2v1c A:2-199 [152408]
   automatically matched to d1vdda_
   protein/DNA complex; complexed with zn; mutant

Details for d2v1ca1

PDB Entry: 2v1c, 3.8 Å

PDB Description: crystal structure and mutational study of recor provide insight into its role in dna repair

PDB Compounds: (A:) recombination protein recr

SCOPe Domain Sequences for d2v1ca1:

Sequence; same for both SEQRES and ATOM records:

>d2v1ca1 e.49.1.1 (A:2-199) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]}
kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
devtlgraltgrqtvskp

Timeline for d2v1ca1:

• d2v1ca1 first appeared in SCOP 1.75
  
• d2v1ca1 appears in SCOPe 2.07