Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (1 family) |
Family d.230.2.1: Dodecin-like [89808] (2 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name |
Protein Uncharacterized protein TTHA1431 [159869] (1 species) |
Species Thermus thermophilus [TaxId:274] [159870] (8 PDB entries) Uniprot Q5SIE3 2-67! Uniprot Q5SIE3 2-68 |
Domain d2v19i1: 2v19 I:2-68 [152404] automatically matched to 2V19 A:2-68 complexed with cl, coa, fmn; mutant |
PDB Entry: 2v19 (more details), 2.59 Å
SCOP Domain Sequences for d2v19i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v19i1 d.230.2.1 (I:2-68) Uncharacterized protein TTHA1431 {Thermus thermophilus [TaxId: 274]} gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeiagtigeagvkeyqvvle vgfrlee
Timeline for d2v19i1: