Lineage for d1bzzc_ (1bzz C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 275721Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 275722Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 275747Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 275852Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 275901Species Human (Homo sapiens) [TaxId:9606] [46487] (100 PDB entries)
  8. 275924Domain d1bzzc_: 1bzz C: [15240]
    Other proteins in same PDB: d1bzzb_, d1bzzd_
    complexed with hem; mutant

Details for d1bzzc_

PDB Entry: 1bzz (more details), 1.59 Å

PDB Description: hemoglobin (alpha v1m) mutant
PDB Compounds: (C:)

SCOP Domain Sequences for d1bzzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzzc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1bzzc_:

Click to download the PDB-style file with coordinates for d1bzzc_.
(The format of our PDB-style files is described here.)

Timeline for d1bzzc_: