![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.2: Dodecin-like [89807] (2 families) ![]() |
![]() | Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
![]() | Protein automated matches [190247] (4 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187586] (6 PDB entries) |
![]() | Domain d2v19c_: 2v19 C: [152398] Other proteins in same PDB: d2v19a1 automated match to d2v19i_ complexed with cl, coa, fmn; mutant |
PDB Entry: 2v19 (more details), 2.59 Å
SCOPe Domain Sequences for d2v19c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v19c_ d.230.2.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeiagtigeagvkeyqvvle vgfrleet
Timeline for d2v19c_: