Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
Protein automated matches [190247] (4 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187586] (6 PDB entries) |
Domain d2v18j_: 2v18 J: [152393] automated match to d2cz8a1 complexed with coa, fmn |
PDB Entry: 2v18 (more details), 2.59 Å
SCOPe Domain Sequences for d2v18j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v18j_ d.230.2.1 (J:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle vgfrleet
Timeline for d2v18j_: