Lineage for d1bzza_ (1bzz A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436191Protein Hemoglobin, alpha-chain [46486] (18 species)
  7. 436253Species Human (Homo sapiens) [TaxId:9606] [46487] (114 PDB entries)
  8. 436278Domain d1bzza_: 1bzz A: [15239]
    Other proteins in same PDB: d1bzzb_, d1bzzd_

Details for d1bzza_

PDB Entry: 1bzz (more details), 1.59 Å

PDB Description: hemoglobin (alpha v1m) mutant
PDB Compounds: (A:)

SCOP Domain Sequences for d1bzza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzza_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1bzza_:

Click to download the PDB-style file with coordinates for d1bzza_.
(The format of our PDB-style files is described here.)

Timeline for d1bzza_: