Lineage for d2v18c_ (2v18 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613923Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 2613924Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 2613934Protein automated matches [190247] (4 species)
    not a true protein
  7. 2613952Species Thermus thermophilus HB8 [TaxId:300852] [187586] (6 PDB entries)
  8. 2613985Domain d2v18c_: 2v18 C: [152386]
    automated match to d2cz8a1
    complexed with coa, fmn

Details for d2v18c_

PDB Entry: 2v18 (more details), 2.59 Å

PDB Description: crystal structure of the t. thermophilus dodecin
PDB Compounds: (C:) dodecin

SCOPe Domain Sequences for d2v18c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v18c_ d.230.2.1 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
gkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvle
vgfrleet

SCOPe Domain Coordinates for d2v18c_:

Click to download the PDB-style file with coordinates for d2v18c_.
(The format of our PDB-style files is described here.)

Timeline for d2v18c_: