Lineage for d2v15l1 (2v15 L:22-172)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766502Species Streptococcus suis [TaxId:1307] [101134] (4 PDB entries)
  8. 766550Domain d2v15l1: 2v15 L:22-172 [152383]
    automatically matched to d1umng_
    complexed with ca, cl, epe, tb

Details for d2v15l1

PDB Entry: 2v15 (more details), 2.1 Å

PDB Description: terbium binding in streptococcus suis dpr protein
PDB Compounds: (L:) DNA protection during starvation protein

SCOP Domain Sequences for d2v15l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v15l1 a.25.1.1 (L:22-172) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
ladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserli
tlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeegd
svtndifnvakasiekhiwmlqaelgqapkl

SCOP Domain Coordinates for d2v15l1:

Click to download the PDB-style file with coordinates for d2v15l1.
(The format of our PDB-style files is described here.)

Timeline for d2v15l1: