| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Dodecameric ferritin homolog [47250] (16 species) |
| Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries) |
| Domain d2v15d_: 2v15 D: [152375] automated match to d1umng_ complexed with ca, cl, epe, tb |
PDB Entry: 2v15 (more details), 2.1 Å
SCOPe Domain Sequences for d2v15d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v15d_ a.25.1.1 (D:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
dsvtndifnvakasiekhiwmlqaelgqapkl
Timeline for d2v15d_: