![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.29.2: GGDEF domain [117984] (1 protein) Pfam PF00990; less decorated than the adenylyl/guanylyl cyclase domain |
![]() | Protein Response regulator PleD, C-terminal domain [117985] (1 species) Diguanylate cyclase |
![]() | Species Caulobacter crescentus [TaxId:155892] [117986] (2 PDB entries) Uniprot Q9A5I5 |
![]() | Domain d2v0nb3: 2v0n B:294-455 [152370] Other proteins in same PDB: d2v0na1, d2v0na2, d2v0nb1, d2v0nb2 automated match to d1w25a3 complexed with bef, c2e, cl, gav, mg, so4 |
PDB Entry: 2v0n (more details), 2.71 Å
SCOPe Domain Sequences for d2v0nb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v0nb3 d.58.29.2 (B:294-455) Response regulator PleD, C-terminal domain {Caulobacter crescentus [TaxId: 155892]} ltglhnrrymtgqldslvkratlggdpvsallididffkkindtfghdigdevlrefalr lasnvraidlpcryggeefvvimpdtaladalriaerirmhvsgspftvahgremlnvti sigvsatagegdtpeallkradegvyqakasgrnavvgkaah
Timeline for d2v0nb3: