Lineage for d2v0na1 (2v0n A:2-140)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837888Protein Response regulator PleD, receiver domain [117472] (1 species)
    duplication: tandem repeat of 2 CheY-like domains
  7. 1837889Species Caulobacter crescentus [TaxId:155892] [117473] (2 PDB entries)
    Uniprot Q9A5I5
  8. 1837890Domain d2v0na1: 2v0n A:2-140 [152365]
    Other proteins in same PDB: d2v0na3, d2v0nb3
    automated match to d1w25a1
    complexed with bef, c2e, cl, gav, mg, so4

Details for d2v0na1

PDB Entry: 2v0n (more details), 2.71 Å

PDB Description: activated response regulator pled in complex with c-digmp and gtp- alpha-s
PDB Compounds: (A:) response regulator pled

SCOPe Domain Sequences for d2v0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v0na1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}
sarilvvddieanvrlleakltaeyyevstamdgptalamaardlpdiilldvmmpgmdg
ftvcrklkddpttrhipvvlitaldgrgdriqglesgasdfltkpiddvmlfarvrsltr
fklvidelrqreasgrrmg

SCOPe Domain Coordinates for d2v0na1:

Click to download the PDB-style file with coordinates for d2v0na1.
(The format of our PDB-style files is described here.)

Timeline for d2v0na1: